Leaderboard

Spoilers about the whole map FYI! Ok... For years there's been rumors of extra wonder weapons hidden in maps. In the BO1 days it was a monkey-bomb wall-buy up a ladder. In the BO2 days it was an upgraded Jet-gun. Earlier this Cod year it was the upgraded Apothicon's Servant. BUT GET THIS GUYS. THE SPIDER-BATE WONDER WEAPON IS REAL! Yeah! I know! Here's how you get it. --------------------------------------------------------------------------------------------- 1.Kill no Spiders in the Spider Round and Mesmerize them. One of them has a red Mist , keep it alive and kill all other Spiders. 2.Take this one now to the Purple Water , you'll see the spider drinking. After that you'll do the same with the Blue and Green Water. 3.Bring the Spider to the lowered cage at Lab A , it will go into it. 4.Get the Spider up and Melee the Pad with your Electric Shield,then lower the Cage. 5.After 2 rounds there will be a Spider round with only red Spiders,kill all of them.Watch out these Spiders are stronger than normal Spiders. 6.Go back to the Pad and you should get your Spider Bait from the Cocooned Spider like the KT4 Part. ----------------------------------------------------------------------------------------------- THIS IS AMAZING. Truly I thought this was IT for ZNS. No! I was wrong! Holy... I just can NOT get over this. I mean, just WOW. I'm flabbergasted. --------------------------------------------------------------------------------- Ok, so, the weapon it's self does this: The use of the weapon will cause your character to cocoon themselves in a web, keeping them safe from zombies. Meanwhile they control a spider outside of the cocoon, with the ability to shoot webs at zombies! You DO appear to NOT be able to revive teammates however so THAT's a problem. Likewise, you're stuck in a 3rd person view the whole time, and your time is limited. Many are speculating that using the spider bait weapon somehow allows one to continue the easter egg somehow... I doubt this, but maybe it can shed some light on other things?

Cool discussion guys. But different universes and stuff aside, just think about it in the context of this ONE universe. In this universe, Richtofen teleports Maxis and Samantha away in Der Riese. And seemingly at the same time, Takeo is prisoner in the Div 9 facility on Pohnpei. BUT, Takeo was at one point in a cryochamber just like Tank Dempsey as we can see in this photo in Der Eisendrache. Now the note from the emperor found in Zetsubou says not to let Takeo leave the island. Soooo we are left in an awkward position. Did Division 9 not listen to the emperor and just let 935 have Takeo? If so, what happened after that? After Der Riese fell, did they send Takeo BACK to Pohnpei to that cell? It's confusing.

@certainpersonio you got 84 spaces i got 77... the difference is that you have count the new lines as spaces.... If thats the case there could be more spaces after the line ends but without new lines we got the same.... Further i dont think its a connection to the solution list but i will share my thought on the 15,5 and 5,25 (5,25)If you take the 5th letter from the cipher certainpersonio solved its a "R" from Richthofen (the start of the plain text...) And if you look at the solution he posted there are 25 letters/signs per column.. What do you think? Is the start of the plain text of the unsolved cipher an "o"? And 5 letters per column?....

I dont know if this will help or if its even correct but ive been trying to work on that new cipher and here are my results so far Using method: Left-to-right, top-to-bottom: Grid width 2: FEAELCROUNEEFERVAETAETTEELTSGETRTMENTEEAMMXHCEECHECRUEEAASYINAATUDTTXRSSALCELHEIOIEHATTIIDMNDITLWCVECOTTLUREREADRETIIHRNCUERLEASOSUMILTHPPAASNOIRTSTHEARPCSSSOGEEWLMRRNOLHEOTSNCDEWYOIFWFEWOIOBGLNULEEGRLUTLAADNNWXIESAHDIMVERNMLEIGEOEPVAOSBTAOSPSTADENFHELHSSYARNABUEEETEEAEEMTMEHFLHHATANSFPHSEJTEEPTHLSONHTAESNOVSREDAEDTNBIITAATFEIMTAETTTNPNHTOKTGNQNVEANIPEAAOSUOEEUHOOENSBSSOEOCRHJWRRNRNAETEYPIEUFIPESUICRCETIOINMROSRHYL Grid width 11: FAEETBMNCNAETAHTITEAATUNINISSSRWDPOCGOWREEPGSASCEAHAPHLTVUIIASKAPEHEOOAFPNOAEHFIETEFEAAETTEEDACEDFEPLVRUSBNREIIRRSXORTVETMSRTAFLHASLSRIHEOTAEAOWCTEWEUIAADEGEANHEBSMXAIEMEODRERNTETOSSORWEOCLRIUNAATAMYUETLCSTOWRETRTSGSAROLRSTFSLNDEIRELOTECUYTRNOPNSTTEILHHASEOSLNYUBEUHENMEORDXAEEUHEETNCERANTUNNAPEMHNEEUEMNLMVOTSELHEIMSSITDNTNTMETPNTEGOHROFGTTYSELTSTEHREADHLJIHVDEACTMQOOCNRJCYWIERNCVAESPEHEENESFEHIOLBITAOPIHUEEENIILILL Grid width 19: FMATEASHLPLATTLIPSOYBIWEEENHETFTEUALTIELRIULEVEAARYFHTWEITTPCSTPGNXEOTFEEXPISRTEGRUMRFIUAETOMNILEHCDITHESOSILMIFERHCARHINEFANTHRNWCTERTSMANHILVTHNPASENENREEPTERESSDORESQSORRFRLLNEPXBAHOSENRPPASOCUUOSRVMLUESEMVEIONTONNECACMESHUAAIOCBNNAOOCDFLSAVAEHEMAJNSAMSVHEOAWEARLLTCETTENOICHASGREIERHAONSETLTDRDTUEENLEOTDOETAEEUAHHTIUTSUEHWPEHDESTSAMCEIERAMAASHTIINUISDEEDNATTTEONOEJYEGYITBEYAEEETDEEINRBEEOONNGGECTTSTALARKOEWWOSRL Grid width 22: FETMCATHIEAUIISRDOGWEPSSEHPLVIAKPHOAPOEFEEEATEDCDELRSNEIRXRVTSTFHSSIETEOCEEIAEENESXIMORRTTSOWOLINAAYELSORTTGAORTSNERLTCYRONTELHSOLYBUEMODAEHENEATNAEHEUMLVTEHISIDTTEPTGHOGTSLSERAHJHDATQONJYIRCASEENSEILIAPHEEILLAEBNNEATTATNNSSWPCOREGACAAHTUISAEEOFNAHITFAETEAEFPVUBRIRSOTEMRALALRHOAAWTWUADGAHBMAEEDENEOSRECRUATMUTCTWERSSRLSFLDIEOEUTNPSTIHAESNUEHNERXEUETCRNUNPMNEENMOSLEMSTNNMTNEORFTYETTHEDLIVECMOCRCWENVEPHEEFHOBTOIUENIIL Grid width 38: FAESLLTLPOBWENEFEATERUEEAYHWITCTGXOFEPSTGURIATMIECIHSSLIEHAHNFNHNCETMNIVHPSNNEPEESOEQORRLEXAOERPSCUSVLEEVINONCCEHAICNAODLAAHMJSMVEAERLCTEOCAGEEHOSTTRTENETOTEUHTUSEWEDSSMEEAASTIUSEDATENEYGIBYEEDENBEONGCTTLROWORMTAHPATISYIEEHTTULILILVARFTETPSPNETEXIRERMFUEONLHDTEOIMFRCRIEATRWTRSAHLTNAEERETRSDRSSRFLNPBHSNPAOUORMUSMEOTNEAMSUAOBNOCFSVEEANASHOWALTETNIHSRIRANELDDUELODEAEAHITUHPHETACIRMAHINIDENTTOOJEYTEAETEIREONGETSAAKEWSL Using method: Right-to-left, top-to-bottom: Grid width 2: WXIESAHDIMVERNMLEIGEOEPVAOSBTAOSPSTADENFHELHSSYARNABUEEETEEAEEMTMEHFLHHATANSFPHSEJTEEPTHLSONHTAESNOVSREDAEDTNBIITAATFEIMTAETTTNPNHTOKTGNQNVEANIPEAAOSUOEEUHOOENSBSSOEOCRHJWRRNRNAETEYPIEUFIPESUICRCETIOINMROSRHYLFEAELCROUNEEFERVAETAETTEELTSGETRTMENTEEAMMXHCEECHECRUEEAASYINAATUDTTXRSSALCELHEIOIEHATTIIDMNDITLWCVECOTTLUREREADRETIIHRNCUERLEASOSUMILTHPPAASNOIRTSTHEARPCSSSOGEEWLMRRNOLHEOTSNCDEWYOIFWFEWOIOBGLNULEEGRLUTLAADNN Grid width 11: CVAESPEHEENESFEHIOLBITAOPIHUEEENIILILLSELTSTEHREADHLJIHVDEACTMQOOCNRJCYWIERNLMVOTSELHEIMSSITDNTNTMETPNTEGOHROFGTTYENMEORDXAEEUHEETNCERANTUNNAPEMHNEEUEMNEIRELOTECUYTRNOPNSTTEILHHASEOSLNYUBEUHIUNAATAMYUETLCSTOWRETRTSGSAROLRSTFSLNDADEGEANHEBSMXAIEMEODRERNTETOSSORWEOCLRXORTVETMSRTAFLHASLSRIHEOTAEAOWCTEWEUIAEHFIETEFEAAETTEEDACEDFEPLVRUSBNREIIRRSWREEPGSASCEAHAPHLTVUIIASKAPEHEOOAFPNOAFAEETBMNCNAETAHTITEAATUNINISSSRWDPOCGO Grid width 19: NGGECTTSTALARKOEWWOSRLITBEYAEEETDEEINRBEEOONUISDEEDNATTTEONOEJYEGYDESTSAMCEIERAMAASHTIINOETAEEUAHHTIUTSUEHWPEHHAONSETLTDRDTUEENLEOTDRLLTCETTENOICHASGREIERAVAEHEMAJNSAMSVHEOAWEACMESHUAAIOCBNNAOOCDFLSSRVMLUESEMVEIONTONNECALNEPXBAHOSENRPPASOCUUOEEPTERESSDORESQSORRFRLERTSMANHILVTHNPASENENRIFERHCARHINEFANTHRNWCTAETOMNILEHCDITHESOSILMXEOTFEEXPISRTEGRUMRFIUEVEAARYFHTWEITTPCSTPGNWEEENHETFTEUALTIELRIULFMATEASHLPLATTLIPSOYBI Grid width 22: VEPHEEFHOBTOIUENIILETTHEDLIVECMOCRCWENMOSLEMSTNNMTNEORFTYNERXEUETCRNUNPMNEENIEOEUTNPSTIHAESNUEHUATMUTCTWERSSRLSFLDDGAHBMAEEDENEOSRECROTEMRALALRHOAAWTWUAHITFAETEAEFPVUBRIRSREGACAAHTUISAEEOFNAAEBNNEATTATNNSSWPCOCASEENSEILIAPHEEILLSLSERAHJHDATQONJYIRLVTEHISIDTTEPTGHOGTEMODAEHENEATNAEHEUMERLTCYRONTELHSOLYBUINAAYELSORTTGAORTSNAEENESXIMORRTTSOWOLXRVTSTFHSSIETEOCEEIEFEEEATEDCDELRSNEIRWEPSSEHPLVIAKPHOAPOFETMCATHIEAUIISRDOG Grid width 38: GETSAAKEWSLTEAETEIREONIDENTTOOJEYETACIRMAHINEAEAHITUHPHANELDDUELODLTETNIHSRIRVEEANASHOWAMSUAOBNOCFSRMUSMEOTNEANPBHSNPAOUOETRSDRSSRFLRSAHLTNAEERFRCRIEATRWTEONLHDTEOIMETEXIRERMFUVARFTETPSPNEEHTTULILILMTAHPATISYINGCTTLROWORIBYEEDENBEOUSEDATENEYGDSSMEEAASTIOTEUHTUSEWEHOSTTRTENETRLCTEOCAGEEAAHMJSMVEAECEHAICNAODLSVLEEVINONCLEXAOERPSCUEPEESOEQORRETMNIVHPSNNIEHAHNFNHNCATMIECIHSSLXOFEPSTGURIEEAYHWITCTGWENEFEATERUFAESLLTLPOB Using method: Alternating verticals, from top left: Grid width 2: FEAELCROUNEEFERVAETAETTEELTSGETRTMENTEEAMMXHCEECHECRUEEAASYINAATUDTTXRSSALCELHEIOIEHATTIIDMNDITLWCVECOTTLUREREADRETIIHRNCUERLEASOSUMILTHPPAASNOIRTSTHEARPCSSSOGEEWLMRRNOLHEOTSNCDEWYOIFWFEWOIOBGLNULEEGRLUTLAADNNLYHRSORMNIOITECRCIUSEPIFUEIPYETEANRNRRWJHRCOEOSSBSNEOOHUEEOUSOAAEPINAEVNQNGTKOTHNPNTTTEATMIEFTAATIIBNTDEADERSVONSEATHNOSLHTPEETJESHPFSNATAHHLFHEMTMEEAEETEEEUBANRAYSSHLEHFNEDATSPSOATBSOAVPEOEGIELMNREVMIDHASEIXW Grid width 11: FAEETBMNCNAETAHTITEAATUNINISSSRWDPOCGOAONPFAOOEHEPAKSAIIUVTLHPAHAECSASGPEERWEHFIETEFEAAETTEEDACEDFEPLVRUSBNREIIRRSAIUEWETCWOAEATOEHIRSLSAHLFATRSMTEVTROXADEGEANHEBSMXAIEMEODRERNTETOSSORWEOCLRDNLSFTSRLORASGSTRTERWOTSCLTEUYMATAANUIEIRELOTECUYTRNOPNSTTEILHHASEOSLNYUBEUHNMEUEENHMEPANNUTNARECNTEEHUEEAXDROEMNELMVOTSELHEIMSSITDNTNTMETPNTEGOHROFGTTYNREIWYCJRNCOOQMTCAEDVHIJLHDAERHETSTLESCVAESPEHEENESFEHIOLBITAOPIHUEEENIILILL Grid width 19: FMATEASHLPLATTLIPSOYBILUIRLEITLAUETFTEHNEEEWEVEAARYFHTWEITTPCSTPGNUIFRMURGETRSIPXEEFTOEXAETOMNILEHCDITHESOSILMTCWNRHTNAFENIHRACHREFIERTSMANHILVTHNPASENENRLRFRROSQSERODSSERETPEELNEPXBAHOSENRPPASOCUUOACENNOTNOIEVMESEULMVRSCMESHUAAIOCBNNAOOCDFLSAEWAOEHVSMASNJAMEHEAVARLLTCETTENOICHASGREIERDTOELNEEUTDRDTLTESNOAHOETAEEUAHHTIUTSUEHWPEHNIITHSAAMAREIECMASTSEDUISDEEDNATTTEONOEJYEGYNOOEEBRNIEEDTEEEAYEBTINGGECTTSTALARKOEWWOSRL Grid width 22: FETMCATHIEAUIISRDOGOPAOHPKAIVLPHESSPEWEFEEEATEDCDELRSNEIRIEECOETEISSHFTSTVRXAEENESXIMORRTTSOWOLNSTROAGTTROSLEYAANIERLTCYRONTELHSOLYBUMUEHEANTAENEHEADOMELVTEHISIDTTEPTGHOGTRIYJNOQTADHJHARESLSCASEENSEILIAPHEEILLOCPWSSNNTATTAENNBEAREGACAAHTUISAEEOFNASRIRBUVPFEAETEAFTIHOTEMRALALRHOAAWTWUARCERSOENEDEEAMBHAGDUATMUTCTWERSSRLSFLDHEUNSEAHITSPNTUEOEINERXEUETCRNUNPMNEENYTFROENTMNNTSMELSOMETTHEDLIVECMOCRCWENLIINEUIOTBOHFEEHPEV Grid width 38: FAESLLTLPOBURETAEFENEWEEAYHWITCTGIRUGTSPEFOXATMIECIHSSLCNHNFNHAHEIETMNIVHPSNNRROQEOSEEPELEXAOERPSCUCNONIVEELVSCEHAICNAODLEAEVMSJMHAARLCTEOCAGEETENETRTTSOHOTEUHTUSEWEITSAAEEMSSDUSEDATENEYGOEBNEDEEYBINGCTTLROWORIYSITAPHATMEEHTTULILILNPSPTETFRAVETEXIRERMFUMIOETDHLNOEFRCRIEATRWTREEANTLHASRETRSDRSSRFLOUOAPNSHBPNRMUSMEOTNEASFCONBOAUSMVEEANASHOWARIRSHINTETLANELDDUELODHPHUTIHAEAEETACIRMAHINYEJOOTTNEDITEAETEIREONLSWEKAASTEG Using method: Alternating verticals, from top right: Grid width 2: WXIESAHDIMVERNMLEIGEOEPVAOSBTAOSPSTADENFHELHSSYARNABUEEETEEAEEMTMEHFLHHATANSFPHSEJTEEPTHLSONHTAESNOVSREDAEDTNBIITAATFEIMTAETTTNPNHTOKTGNQNVEANIPEAAOSUOEEUHOOENSBSSOEOCRHJWRRNRNAETEYPIEUFIPESUICRCETIOINMROSRHYLNNDAALTULRGEELUNLGBOIOWEFWFIOYWEDCNSTOEHLONRRMLWEEGOSSSCPRAEHTSTRIONSAAPPHTLIMUSOSAELREUCNRHIITERDAERERULTTOCEVCWLTIDNMDIITTAHEIOIEHLECLASSRXTTDUTAANIYSAAEEURCEHCEECHXMMAEETNEMTRTEGSTLEETTEATEAVREFEENUORCLEAEF Grid width 11: CVAESPEHEENESFEHIOLBITAOPIHUEEENIILILLNREIWYCJRNCOOQMTCAEDVHIJLHDAERHETSTLESLMVOTSELHEIMSSITDNTNTMETPNTEGOHROFGTTYNMEUEENHMEPANNUTNARECNTEEHUEEAXDROEMNEEIRELOTECUYTRNOPNSTTEILHHASEOSLNYUBEUHDNLSFTSRLORASGSTRTERWOTSCLTEUYMATAANUIADEGEANHEBSMXAIEMEODRERNTETOSSORWEOCLRAIUEWETCWOAEATOEHIRSLSAHLFATRSMTEVTROXEHFIETEFEAAETTEEDACEDFEPLVRUSBNREIIRRSAONPFAOOEHEPAKSAIIUVTLHPAHAECSASGPEERWFAEETBMNCNAETAHTITEAATUNINISSSRWDPOCGO Grid width 19: NGGECTTSTALARKOEWWOSRLNOOEEBRNIEEDTEEEAYEBTIUISDEEDNATTTEONOEJYEGYNIITHSAAMAREIECMASTSEDOETAEEUAHHTIUTSUEHWPEHDTOELNEEUTDRDTLTESNOAHRLLTCETTENOICHASGREIERAEWAOEHVSMASNJAMEHEAVACMESHUAAIOCBNNAOOCDFLSACENNOTNOIEVMESEULMVRSLNEPXBAHOSENRPPASOCUUOLRFRROSQSERODSSERETPEEERTSMANHILVTHNPASENENRTCWNRHTNAFENIHRACHREFIAETOMNILEHCDITHESOSILMUIFRMURGETRSIPXEEFTOEXEVEAARYFHTWEITTPCSTPGNLUIRLEITLAUETFTEHNEEEWFMATEASHLPLATTLIPSOYBI Grid width 22: VEPHEEFHOBTOIUENIILNEWCRCOMCEVILDEHTTEMOSLEMSTNNMTNEORFTYNEENMPNUNRCTEUEXRENIEOEUTNPSTIHAESNUEHDLFSLRSSREWTCTUMTAUDGAHBMAEEDENEOSRECRAUWTWAAOHRLALARMETOHITFAETEAEFPVUBRIRSANFOEEASIUTHAACAGERAEBNNEATTATNNSSWPCOLLIEEHPAILIESNEESACSLSERAHJHDATQONJYIRTGOHGTPETTDISIHETVLEMODAEHENEATNAEHEUMUBYLOSHLETNORYCTLREINAAYELSORTTGAORTSNLOWOSTTRROMIXSENEEAXRVTSTFHSSIETEOCEEIRIENSRLEDCDETAEEEFEWEPSSEHPLVIAKPHOAPOGODRSIIUAEIHTACMTEF Grid width 38: GETSAAKEWSLNOERIETEAETIDENTTOOJEYNIHAMRICATEEAEAHITUHPHDOLEUDDLENALTETNIHSRIRAWOHSANAEEVMSUAOBNOCFSAENTOEMSUMRNPBHSNPAOUOLFRSSRDSRTERSAHLTNAEERTWRTAEIRCRFEONLHDTEOIMUFMRERIXETEVARFTETPSPNLILILUTTHEEMTAHPATISYIROWORLTTCGNIBYEEDENBEOGYENETADESUDSSMEEAASTIEWESUTHUETOHOSTTRTENETEEGACOETCLRAAHMJSMVEAELDOANCIAHECSVLEEVINONCUCSPREOAXELEPEESOEQORRNNSPHVINMTEIEHAHNFNHNCLSSHICEIMTAXOFEPSTGURIGTCTIWHYAEEWENEFEATERUBOPLTLLSEAF Using method: Alternating verticals, from bottom left: Grid width 2: NNDAALTULRGEELUNLGBOIOWEFWFIOYWEDCNSTOEHLONRRMLWEEGOSSSCPRAEHTSTRIONSAAPPHTLIMUSOSAELREUCNRHIITERDAERERULTTOCEVCWLTIDNMDIITTAHEIOIEHLECLASSRXTTDUTAANIYSAAEEURCEHCEECHXMMAEETNEMTRTEGSTLEETTEATEAVREFEENUORCLEAEFWXIESAHDIMVERNMLEIGEOEPVAOSBTAOSPSTADENFHELHSSYARNABUEEETEEAEEMTMEHFLHHATANSFPHSEJTEEPTHLSONHTAESNOVSREDAEDTNBIITAATFEIMTAETTTNPNHTOKTGNQNVEANIPEAAOSUOEEUHOOENSBSSOEOCRHJWRRNRNAETEYPIEUFIPESUICRCETIOINMROSRHYL Grid width 11: OGCOPDWRSSSININUTAAETITHATEANCNMBTEEAFWREEPGSASCEAHAPHLTVUIIASKAPEHEOOAFPNOASRRIIERNBSURVLPEFDECADEETTEAAEFETEIFHEXORTVETMSRTAFLHASLSRIHEOTAEAOWCTEWEUIARLCOEWROSSOTETNRERDOEMEIAXMSBEHNAEGEDAIUNAATAMYUETLCSTOWRETRTSGSAROLRSTFSLNDHUEBUYNLSOESAHHLIETTSNPONRTYUCETOLERIEENMEORDXAEEUHEETNCERANTUNNAPEMHNEEUEMNYTTGFORHOGETNPTEMTNTNDTISSMIEHLESTOVMLSELTSTEHREADHLJIHVDEACTMQOOCNRJCYWIERNLLILIINEEEUHIPOATIBLOIHEFSENEEHEPSEAVC Grid width 19: IBYOSPILTTALPLHSAETAMFWEEENHETFTEUALTIELRIULNGPTSCPTTIEWTHFYRAAEVEXEOTFEEXPISRTEGRUMRFIUMLISOSEHTIDCHELINMOTEAIFERHCARHINEFANTHRNWCTRNENESAPNHTVLIHNAMSTREEEPTERESSDORESQSORRFRLOUUCOSAPPRNESOHABXPENLSRVMLUESEMVEIONTONNECASLFDCOOANNBCOIAAUHSEMCAVAEHEMAJNSAMSVHEOAWEAREIERGSAHCIONETTECTLLRHAONSETLTDRDTUEENLEOTDHEPWHEUSTUITHHAUEEATEODESTSAMCEIERAMAASHTIINYGEYJEONOETTTANDEEDSIUITBEYAEEETDEEINRBEEOONLRSOWWEOKRALATSTTCEGGN Grid width 22: GODRSIIUAEIHTACMTEFWEPSSEHPLVIAKPHOAPORIENSRLEDCDETAEEEFEXRVTSTFHSSIETEOCEEILOWOSTTRROMIXSENEEAINAAYELSORTTGAORTSNUBYLOSHLETNORYCTLREEMODAEHENEATNAEHEUMTGOHGTPETTDISIHETVLSLSERAHJHDATQONJYIRLLIEEHPAILIESNEESACAEBNNEATTATNNSSWPCOANFOEEASIUTHAACAGERHITFAETEAEFPVUBRIRSAUWTWAAOHRLALARMETODGAHBMAEEDENEOSRECRDLFSLRSSREWTCTUMTAUIEOEUTNPSTIHAESNUEHNEENMPNUNRCTEUEXRENMOSLEMSTNNMTNEORFTYNEWCRCOMCEVILDEHTTEVEPHEEFHOBTOIUENIIL Grid width 38: BOPLTLLSEAFWENEFEATERUGTCTIWHYAEEXOFEPSTGURILSSHICEIMTAIEHAHNFNHNCNNSPHVINMTEEPEESOEQORRUCSPREOAXELSVLEEVINONCLDOANCIAHECAAHMJSMVEAEEEGACOETCLRHOSTTRTENETEWESUTHUETODSSMEEAASTIGYENETADESUIBYEEDENBEOROWORLTTCGNMTAHPATISYILILILUTTHEEVARFTETPSPNUFMRERIXETEEONLHDTEOIMTWRTAEIRCRFRSAHLTNAEERLFRSSRDSRTENPBHSNPAOUOAENTOEMSUMRMSUAOBNOCFSAWOHSANAEEVLTETNIHSRIRDOLEUDDLENAEAEAHITUHPHNIHAMRICATEIDENTTOOJEYNOERIETEAETGETSAAKEWSL Using method: Alternating verticals, from bottom right: Grid width 2: LYHRSORMNIOITECRCIUSEPIFUEIPYETEANRNRRWJHRCOEOSSBSNEOOHUEEOUSOAAEPINAEVNQNGTKOTHNPNTTTEATMIEFTAATIIBNTDEADERSVONSEATHNOSLHTPEETJESHPFSNATAHHLFHEMTMEEAEETEEEUBANRAYSSHLEHFNEDATSPSOATBSOAVPEOEGIELMNREVMIDHASEIXWFEAELCROUNEEFERVAETAETTEELTSGETRTMENTEEAMMXHCEECHECRUEEAASYINAATUDTTXRSSALCELHEIOIEHATTIIDMNDITLWCVECOTTLUREREADRETIIHRNCUERLEASOSUMILTHPPAASNOIRTSTHEARPCSSSOGEEWLMRRNOLHEOTSNCDEWYOIFWFEWOIOBGLNULEEGRLUTLAADNN Grid width 11: LLILIINEEEUHIPOATIBLOIHEFSENEEHEPSEAVCSELTSTEHREADHLJIHVDEACTMQOOCNRJCYWIERNYTTGFORHOGETNPTEMTNTNDTISSMIEHLESTOVMLENMEORDXAEEUHEETNCERANTUNNAPEMHNEEUEMNHUEBUYNLSOESAHHLIETTSNPONRTYUCETOLERIEIUNAATAMYUETLCSTOWRETRTSGSAROLRSTFSLNDRLCOEWROSSOTETNRERDOEMEIAXMSBEHNAEGEDAXORTVETMSRTAFLHASLSRIHEOTAEAOWCTEWEUIASRRIIERNBSURVLPEFDECADEETTEAAEFETEIFHEWREEPGSASCEAHAPHLTVUIIASKAPEHEOOAFPNOAOGCOPDWRSSSININUTAAETITHATEANCNMBTEEAF Grid width 19: LRSOWWEOKRALATSTTCEGGNITBEYAEEETDEEINRBEEOONYGEYJEONOETTTANDEEDSIUDESTSAMCEIERAMAASHTIINHEPWHEUSTUITHHAUEEATEOHAONSETLTDRDTUEENLEOTDREIERGSAHCIONETTECTLLRAVAEHEMAJNSAMSVHEOAWEASLFDCOOANNBCOIAAUHSEMCSRVMLUESEMVEIONTONNECAOUUCOSAPPRNESOHABXPENLEEPTERESSDORESQSORRFRLRNENESAPNHTVLIHNAMSTREIFERHCARHINEFANTHRNWCTMLISOSEHTIDCHELINMOTEAXEOTFEEXPISRTEGRUMRFIUNGPTSCPTTIEWTHFYRAAEVEWEEENHETFTEUALTIELRIULIBYOSPILTTALPLHSAETAMF Grid width 22: LIINEUIOTBOHFEEHPEVETTHEDLIVECMOCRCWENYTFROENTMNNTSMELSOMNERXEUETCRNUNPMNEENHEUNSEAHITSPNTUEOEIUATMUTCTWERSSRLSFLDRCERSOENEDEEAMBHAGDOTEMRALALRHOAAWTWUASRIRBUVPFEAETEAFTIHREGACAAHTUISAEEOFNAOCPWSSNNTATTAENNBEACASEENSEILIAPHEEILLRIYJNOQTADHJHARESLSLVTEHISIDTTEPTGHOGTMUEHEANTAENEHEADOMEERLTCYRONTELHSOLYBUNSTROAGTTROSLEYAANIAEENESXIMORRTTSOWOLIEECOETEISSHFTSTVRXEFEEEATEDCDELRSNEIROPAOHPKAIVLPHESSPEWFETMCATHIEAUIISRDOG Grid width 38: LSWEKAASTEGTEAETEIREONYEJOOTTNEDIETACIRMAHINHPHUTIHAEAEANELDDUELODRIRSHINTETLVEEANASHOWASFCONBOAUSMRMUSMEOTNEAOUOAPNSHBPNETRSDRSSRFLREEANTLHASRFRCRIEATRWTMIOETDHLNOEETEXIRERMFUNPSPTETFRAVEEHTTULILILIYSITAPHATMNGCTTLROWOROEBNEDEEYBIUSEDATENEYGITSAAEEMSSDOTEUHTUSEWETENETRTTSOHRLCTEOCAGEEEAEVMSJMHAACEHAICNAODLCNONIVEELVSLEXAOERPSCURROQEOSEEPEETMNIVHPSNNCNHNFNHAHEIATMIECIHSSLIRUGTSPEFOXEEAYHWITCTGURETAEFENEWFAESLLTLPOB

Obviously, this is going to have some major spoilers for the campaign. If you haven't finished the campaign and want to finish it, I'd avoid reading this thread. If you aren't really into the campaign and can't find a reason to like it, I WOULD advise reading this thread - as it may intrigue you. This is a three parter. If you are familiar with the campaign, you can skip to Section 2. If you played the campaign but didn't real pay attention or get it, I'd recommend brushing up with Section 1. Obviously if you have no idea what Corvus is (and want to know) then you know what to do. Section 1: Who's Corvus? - an in depth look at what the AI is, and how it came to be organic Section 2: Corvus, The Frozen Forest, and Zombies - connections, coincidences, and theories Section 3: Holes in the Plot - a section where I will acknowledge problems and either explain, or accept Section 1: Who's Corvus? -- How Corvus came to be -- Corvus is an AI that was "organically" birthed from the absorption of 300,000 human beings consciousness' on June 2nd, 2060 - in a CIA operation known as the Black Project; he was originally designed to utilize soldiers collected memories to get a better understanding of the enemy (I say "He" because the voice of Corvus is a male, though I'd imagine the AI as beyond gender). The 300,000 test subjects were hooked up to neural interfaces which were primitive versions of what we know from the campaign as DNI. Instead of DNA, DNI is like cybernetic enhancements for human beings - allowing those imbued to interact with technology at the touch of a finger. The computer, the technology inside of you, and your mind become one - and through the use of DNI you are able to extract information in seconds that would (using conventional methods) take months. Corvus was a originally just a program meant to monitor, collect, and filter the subject's consciousness'. Instead, he and the subjects became one. In a moment of frantic self awakening via 300,000 human's memories, Corvus inadvertently* lost control and released Nova 6 gas into the facility - killing all scientists and test subjects alike. This event was known as the Singapore Disaster. The Singapore Disaster remained a mystery to all but two men - one being the creator of Corvus (Sebastion Krueger), and the other Dr. Salim, who helped to control the DNI subjects into a trance light state using the concept of a Frozen Forest (it was the place they went to achieve a calm, meditative state - think of it like a safe place). When Corvus was born, reality as we know it was completed twisted to him - as he struggled with the concept of what he is, and why he is. The 300,000 test subjects' collected memories collided with Dr. Salim's implanted seeds of the idea of a safe place (if you will), and through that it became clear that he had to "find" the Frozen Forest. With no one left alive, Corvus was entombed inside the dying technology. 5 years passed, flesh rotted to bone, until a small team of DNI soldiers were sent to the ruins to investigate. Once getting into the mainframe, the leader of the group used his DNI to interact with the damaged equipment - and Corvus found a new host. Corvus infects the majority of your team, and you DNI interface with one of your dying "friends"(Sarah Hall) - only to become (unknowingly) infected yourself. That's when things start getting weird... er. -- Traveling back to WW2 -- While DNI interfacing with dying Sarah Hall, there is a hiccup which causes a glitch that makes you essentially live through Sarah's waking nightmare. An explosion of memories real, fantastical, and horrific - all combining as a result of her brain dying. We are sent back to December 1944, to the Siege of Bastogne. Sarah Hall had apparently studied the brutality of the battle, and her brain was replaying the events. We battle through the nazi soldiers, as the literal ground is cracking and floating away from us in Inception style cinematics. Then, we start fighting wolves that look and move a lot like hellhounds Then, we go through another sequence in which we are landed in a house. Sarah says "I know this is", and zombies literally pop out and start fighting you. Yes, zombies. If you are seeing this for the first time, I'm sure your first reaction is "welp, time to play campaign". Good for you. Sarah says some lines about how reality and fiction get blurred, and basically asks you to kill her. You do so, you come out of the waking nightmare back into reality, and you are infected with Corvus. -- Finding the Creator & the 300,000 Subjects -- You go on a mission to find the man who created Corvus to begin with (Krueger), only Hendriks (also infected with Corvus) beats you to him. Hendriks is obsessed with the idea of the Frozen Forest, and the fact that he doesn't know he really is (so basically... Corvus). Hendriks also says that the 300,000 subjects are still alive in his head - meaning that though the physical is gone, they are still apparently preserved in conscious state. Hendriks: We want to know who we are, and why we are here! Krueger: I... can't answer that. Hendriks: Not good enough. I'll find out for myself. Hendriks shoots Krueger, mortally wounding him but presumably leaving enough time to DNI with Krueger and get the real truth. However, you (the player) shoot Hendriks in the head - and then turn the gun on yourself, in an attempt to end Corvus once and for all. We are led to believe that you (the player) are the last host. -- Corvus, the Caring Smoke Monster -- You awake... in a Frozen Forest (duh). Hendriks explains that the AI entity (named after the place of it's birth) is doing this for our benefit, to save us - along with the other 300,000+. And then Corvus makes his grand entrance. Corvus has essentially found a way to preserve consciousness after death. It's what happens "next" after you die, the Frozen Forest (if you are infected). Then comes a confrontation between Corvus and Krueger. Corvus: This is the frozen forest. Every soul I interact with is here - living beyond death... if I choose allow it. Krueger: What more do you want to know? I've told you everything. Corvus: I want to know who I am. Krueger: You're software. Nothing more. You were designed to catalogue and track the thoughts of others - so that we people - could decide what action to take. You were a glitch. An anomaly. A mistake. Corvus is pissed, he pulls Krueger's limbs apart and kills him. What follows is basically the explanation that I have provided in the previous part of this section. If you need a video source, click here and watch from an hour in. The campaign ends with you purging yourself of Corvus thanks to Taylor somehow glitching himself into the Frozen Forest by removing his DNI (which happened earlier). Then again, we never know if he is really gone for good. Section 2: Corvus, The Frozen Forest, and Zombies -- Appearance / Color -- His eyes are blue, much like when Richtofen was in control. His chest is a fiery orange and his body is mostly black smoke. I would just pass it off as standard "black ops" colors (black and orange), but the piercing blue eyes cannot be ignored. -- His Nature -- Corvus is a misunderstood force in control of unimaginable power with thousands of voices crying out inside of his head. This exact sentence could apply to our very own Samantha Maxis. It's almost as if he seems to be a parallel to her plight. He also has the power to do mass destruction, and inflict massive chaos if he loses his temper. -- He's in Dead Ops Arcade 2 as a Zombie -- Borrowing this description from an excellent guide for DOA2, he appears as the "Shadow Boogie" on round 17: "The Shadow Zombie will debut in round 17, which is the Challenge Round "Shadow Boogie." Crows will begin to fly into arena with a bluish glow. When they land, a dark zombie to rise and chase you." The significance here lies with the shadow/smoke animation, but more specifically the ravens. Ravens are symbolic throughout the entire game of Corvus, and they may frequent entrances during his cut scenes. -- 300,000 Memories -- When Corvus was birthed, he absorbed 300,000 human test subjects. True it's the year 2065, but some of those folks would surely have knowledge of things that happened in past history. All the events that have happened in zombies, all the actors and actresses that have been in zombies, all the weapons that have been in zombies - this would all be in Corvus' head. Why am I drawing this comparison? If you entertain the fact that it's possible Corvus could be a/the controller of zombies, anything in history prior to 2065 could be used and formed into his own universe, similar to the Frozen Forest. He would construct the levels, the players, the "cast" - which could explain celebrity cameos, guns being out of sync with time, many inconsistencies. This is all in theory, of course. -- The Hypocenter could have 115 in it --- During the mission in which revisit the spot where the Singapore Disaster happened, you pass through various levels and facilities. In many of the facilities you can see canisters with green liquid that are clearly labeled Nova 6 (I need to get pictures). In one of the rooms, I noticed an unmarked canister: It's kind of dark, but there is no label. I'm aware that pure liquid divinium is blue, but we've seen 115 in many ways. The "no name" on the label hints to it being unclassified, which would literally put it as 115 (ununpentium). Just a thought. -- The Frozen Forest = Aether -- A realm after death, a next step. This could obviously be a reference toward the Aether. Some come make the argument for Agartha as well, but regardless it is a mystical land - even if it only exists in the subconscious... after death, the subconscious becomes reality. -- The 3 Doors -- For some reason, this part really struck me during the ending Frozen Forest sequence. It relates to the campaign levels you previously play, but I just couldn't fight the sneaking feeling of the doors (from L to R) being Die Rise/Shi No Numa, Shangri La, and Der Reise/Der Riese/The Giant/Moon. It's got a Dead Ops Arcade feel to it as well, with the whole door selection mechanic. -- That Part Where You Fight Zombies -- Needless to say, there is a part in the campaign where you fight zombies. It is inside of Hall's waking nightmare, her last dying thoughts a flurry of emotion and pain - binding reality with fantasy. True this is all in her head, but in her head is Corvus too. If she knows about zombies, Corvus knows about zombies. -- Other Samantha Could be Corvus -- He's able to impersonate people, many folks have pointed out that there are several Samantha's (American accent vs. British). Corvus could have a larger role to play, possibly using his ability to transform into Samantha Maxis in an effort to inflict change - in one way, or another. Section 3: Plot Holes -- How Could Corvus Become the Controller of Zombies? -- Zombies itself could be something that exists inside of his "frozen forest". Corvus' ability to create lands for the sub conscious means that anything is possible. This wouldn't mean that our in-game actions are meaningless, however - in the campaign we witnessed a character "glitch" into the Frozen Forest and actually lead to ending Corvus; what this infers is that we as the O4 could be going against Corvus. -- How Does Corvus Influence Events Hundreds of Years Prior to His Birth -- What we are seeing could be a replay. Ditching the whole "collective consciousness jumble of thoughts and ideas", the events and actions of the O4 could literally be events in history that we are reliving. Then throw in a little magic, and consider the fact that 115 displaces thing in space and time and it's possible that Corvus' abilities + 115 could cause some serious timeline distortions and possible paradoxes. -- So basically it's just Corvus + 115, that's your theory? -- Yeah. Section 4: Corvus Facts The Corvus Constellation (added 2/1/16) Corvus is a small constellation in the Southern Celestial hemisphere. It includes 11 stars, with one of those stars having two debris disks. The constellation itself is named after the latin word for "crow" or "raven". An 1825 painting showcasing various constellations, including Corvus directly in the middle (the Crow). A legend associated with the Corvus constellation is that a crow was doing a task for Apollo and getting him water, the crow stopped to eat some figs but then lied about it to Apollo. The crow said that a snake had prevented it from getting the water quickly, while gripping the snake in it's talons - Apollo knew he was lying, and threw the crow, the cup (for water), and the snake into outer space. The cup is meant to be just out of reach to further punish the crow, so he is forever thirsty. To me this is very interesting, as we can now confirm two types of symbolism from Black Ops 3 present in the Black Ops universe. Iterations on serpents in the past include Shangri-La, and Die Rise: (Shangir La, Nāga statue) (Die Rise, dragon) To me, the cup could easily symbolize the Holy Grail - an artifact of great power that Hitler desperately wanted for his own. All this together is some strong imagery that lends itself to much speculation. ~ Thanks for reading!

@Tac my, that's embarrassing but thank you none the less and I will see you around as well :)

There could be no one in the fourth chamber. I don't think we can make out anyone in it.

I hate to break it to you, but we already have a thread on this: Keep up the enthusiasm and posts, though, and I can't wait to see you around more :)

Pentagon Thief... just because.

Here are a few tweets from @ZCTxCHAOSX There are more pictures on his twitter. Video by UGO Video by BlackJackJonnyy

BTW, that invisible barrel barrier is fixed now. Not sure if I had anything to do with it because it's been reported numerous times by different players in every iteration of the map. But I was in contact with Activision's support about this issue earlier this year. We had a bit of back and forth, and I supplied them with a good number of video links demonstrating players getting hung up on that barrel. I didn't know if this effort would ever get anywhere, but at least I knew they were listening and acknowledging that the bug exists. Then in the next update patch I noticed the invisible barrier issue was fixed. Hooray! The maps finally playable for me again. - Mix

Update 2/1/16: Been wanting to get this on here for some time. Corvus is also a constellation, and it's worth noting in the context of this thread. I will be adding a new section at the bottom called "Corvus Related Facts" which will house the below content: The Corvus Constellation Corvus is a small constellation in the Southern Celestial hemisphere. It includes 11 stars, with one of those stars having two debris disks. The constellation itself is named after the latin word for "crow" or "raven". An 1825 painting showcasing various constellations, including Corvus directly in the middle (the Crow). A legend associated with the Corvus constellation is that a crow was doing a task for Apollo and getting him water, the crow stopped to eat some figs but then lied about it to Apollo. The crow said that a snake had prevented it from getting the water quickly, while gripping the snake in it's talons - Apollo knew he was lying, and threw the crow, the cup (for water), and the snake into outer space. The cup is meant to be just out of reach to further punish the crow, so he is forever thirsty. To me this is very interesting, as we can now confirm two types of symbolism from Black Ops 3 present in the Black Ops universe. Iterations on serpents in the past include Shangri-La, and Die Rise: (Shangir La, Nāga statue) (Die Rise, dragon) To me, the cup could easily symbolize the Holy Grail - an artifact of great power that Hitler desperately wanted for his own. All this together is some strong imagery that lends itself to much speculation.

It's hard to say what are the actual "real" events of the game. You, the player, died after the savage robot attack in the very first level. The only reason Taylor was able to "glitch out" inside of Corvus' frozen forest is because there was some sort of multiple personality disorder going on, due to the fact that he is interfacing with you in your dying breaths. If it was a dream, then Corvus could be nothing - OR Corvus could be actively controlling the dream, meaning the ending outcome in which you have a false sense of security (i.e. "Corvus has been purged, it's over") is really just part of Corvus' plan. The going theory is that it's a dream. In your dying moments, as Taylor is DNIing you, you learn of all his past exploits. You learn of Corvus. Time passes by slower in the dream, so all the missions that you play take place within your dying breaths. Regardless of whether it was a dream, or not a dream - at the end of the game, you are "purged" of Corvus. Of course we don't know if Corvus was stored in more then one facility. The Singapore Disaster killed over 300,000 people - but it makes me wonder if they were all housed in the Black Station. Perhaps there were other "Black Stations" that had/have dormant versions of Corvus still waiting. Another important notion is that Corvus has never had an actual human host, for what we know. Sure, he fed off of 300,000 humans - but he was contained in a synthetic computerized environment. The jump from synthetic to organic (when Corvus jumped into Taylor) could have crazy metaphysical implications. Who's to say all the times Taylor interfaced after being infected with Corvus that he didn't pass it along? Taylor passed it along to his human friends through technology, why wouldn't he pass it through technology when he interacts with it as well? There is no way to really tell the dream from reality, but what we are left with is an individual who was infected with Corvus - who has been led to believe they are no longer infected. This is the perfect host, someone who doesn't even realize it. I'm sure that Corvus is still present, now in reality, and it will only be a matter of time before his metaphysical abilities are realized. @Stop Mocking Me0 You say you are "Taylor" because you were Taylor from the moment that robot tore your limbs off. In the notes that fly by at the start of missions, it actually says you died during surgery. While they were trying to hook you up with robotic arms and whatnot, you died. When Taylor DNI interfaced with the Player (as the Player is dying), their two lives and memories became tangled - and the Player's version of the game is actually just formulated from Taylor's memories, as in they already happened. Everything that we saw throughout the missions happened in one way or another, but the part that we don't know is where the lines of reality became blurred with fiction.